| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) ![]() |
| Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins) members of this "family" may be more closely related to other ferredoxins than to each other in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
| Protein Dihydropyrimidine dehydrogenase, C-terminal domain [54891] (1 species) includes linker from domain 4 |
| Species Pig (Sus scrofa) [TaxId:9823] [54892] (9 PDB entries) |
| Domain d1gthb5: 1gth B:845-1020 [70492] Other proteins in same PDB: d1gtha1, d1gtha2, d1gtha3, d1gtha4, d1gthb1, d1gthb2, d1gthb3, d1gthb4, d1gthc1, d1gthc2, d1gthc3, d1gthc4, d1gthd1, d1gthd2, d1gthd3, d1gthd4 complexed with fad, fmn, idh, iur, ndp, sf4, ura |
PDB Entry: 1gth (more details), 2.25 Å
SCOPe Domain Sequences for d1gthb5:
Sequence, based on SEQRES records: (download)
>d1gthb5 d.58.1.5 (B:845-1020) Dihydropyrimidine dehydrogenase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
elqgwdgqspgteshqkgkpvpriaelmgkklpnfgpyleqrkkiiaeekmrlkeqnaaf
pplerkpfipkkpipaikdvigkalqylgtfgelsnieqvvavideemcincgkcymtcn
dsgyqaiqfdpethlptvtdtctgctlclsvcpiidcirmvsrttpyepkrglpla
>d1gthb5 d.58.1.5 (B:845-1020) Dihydropyrimidine dehydrogenase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
elqgwdgqspgteshqkgkpvpriaelmgkklpnfgpyleqrkkiiaeekmrlkeqerkp
fipkkpipaikdvigkalqylgtfgelsnieqvvavideemcincgkcymtcndsgyqai
qfdpethlptvtdtctgctlclsvcpiidcirmvsrttpyepkrglpla
Timeline for d1gthb5:
View in 3DDomains from same chain: (mouse over for more information) d1gthb1, d1gthb2, d1gthb3, d1gthb4 |