Lineage for d1gthb4 (1gth B:184-287,B:441-532)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2850289Fold c.4: Nucleotide-binding domain [51970] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
  4. 2850290Superfamily c.4.1: Nucleotide-binding domain [51971] (3 families) (S)
    this superfamily shares the common nucleotide-binding site with and provides a link between the Rossmann-fold NAD(P)-binding and FAD/NAD(P)-binding domains
  5. 2850291Family c.4.1.1: N-terminal domain of adrenodoxin reductase-like [51972] (5 proteins)
  6. 2850304Protein Dihydropyrimidine dehydrogenase, domain 2 [51977] (1 species)
  7. 2850305Species Pig (Sus scrofa) [TaxId:9823] [51978] (9 PDB entries)
  8. 2850335Domain d1gthb4: 1gth B:184-287,B:441-532 [70491]
    Other proteins in same PDB: d1gtha1, d1gtha2, d1gtha3, d1gtha5, d1gthb1, d1gthb2, d1gthb3, d1gthb5, d1gthc1, d1gthc2, d1gthc3, d1gthc5, d1gthd1, d1gthd2, d1gthd3, d1gthd5
    complexed with fad, fmn, idh, iur, ndp, sf4, ura

Details for d1gthb4

PDB Entry: 1gth (more details), 2.25 Å

PDB Description: dihydropyrimidine dehydrogenase (dpd) from pig, ternary complex with nadph and 5-iodouracil
PDB Compounds: (B:) dihydropyrimidine dehydrogenase

SCOPe Domain Sequences for d1gthb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gthb4 c.4.1.1 (B:184-287,B:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]}
eaysakiallgagpasiscasflarlgysditifekqeyvgglstseipqfrlpydvvnf
eielmkdlgvkiicgkslseneitlntlkeegykaafigiglpeXvlrdpkvkealspik
fnrwdlpevdpetmqtsepwvfaggdivgmanttvesvndgkqaswyihkyiqaqygasv
sakpelplfytpvdlvd

SCOPe Domain Coordinates for d1gthb4:

Click to download the PDB-style file with coordinates for d1gthb4.
(The format of our PDB-style files is described here.)

Timeline for d1gthb4: