Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) |
Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins) |
Protein Dihydropyrimidine dehydrogenase, domain 4 [51410] (1 species) |
Species Pig (Sus scrofa) [TaxId:9823] [51411] (5 PDB entries) |
Domain d1gthb2: 1gth B:533-844 [70489] Other proteins in same PDB: d1gtha1, d1gtha3, d1gtha4, d1gtha5, d1gthb1, d1gthb3, d1gthb4, d1gthb5, d1gthc1, d1gthc3, d1gthc4, d1gthc5, d1gthd1, d1gthd3, d1gthd4, d1gthd5 complexed with fad, fmn, idh, iur, ndp, sf4, ura |
PDB Entry: 1gth (more details), 2.25 Å
SCOPe Domain Sequences for d1gthb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gthb2 c.1.4.1 (B:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]} isvemaglkfinpfglasaapttsssmirrafeagwgfaltktfsldkdivtnvsprivr gttsgpmygpgqssflnielisektaaywcqsvtelkadfpdniviasimcsynkndwme lsrkaeasgadalelnlscphgmgergmglacgqdpelvrnicrwvrqavqipffakltp nvtdivsiaraakeggadgvtatntvsglmglkadgtpwpavgagkrttyggvsgtairp ialravttiaralpgfpilatggidsaesglqflhsgasvlqvcsavqnqdftviqdyct glkallylksie
Timeline for d1gthb2:
View in 3D Domains from same chain: (mouse over for more information) d1gthb1, d1gthb3, d1gthb4, d1gthb5 |