Lineage for d1gthb1 (1gth B:2-183)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1253685Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1256293Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) (S)
    contains two Fe4-S4 clusters
  5. 1256342Family a.1.2.2: Dihydropyrimidine dehydrogenase, N-terminal domain [46553] (1 protein)
  6. 1256343Protein Dihydropyrimidine dehydrogenase, N-terminal domain [46554] (1 species)
    includes the N-terminal tail and the linker to domain 2
  7. 1256344Species Pig (Sus scrofa) [TaxId:9823] [46555] (5 PDB entries)
  8. 1256358Domain d1gthb1: 1gth B:2-183 [70488]
    Other proteins in same PDB: d1gtha2, d1gtha3, d1gtha4, d1gtha5, d1gthb2, d1gthb3, d1gthb4, d1gthb5, d1gthc2, d1gthc3, d1gthc4, d1gthc5, d1gthd2, d1gthd3, d1gthd4, d1gthd5
    complexed with fad, fmn, idh, iur, ndp, sf4, ura

Details for d1gthb1

PDB Entry: 1gth (more details), 2.25 Å

PDB Description: dihydropyrimidine dehydrogenase (dpd) from pig, ternary complex with nadph and 5-iodouracil
PDB Compounds: (B:) dihydropyrimidine dehydrogenase

SCOPe Domain Sequences for d1gthb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gthb1 a.1.2.2 (B:2-183) Dihydropyrimidine dehydrogenase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
apvlskdvadiesilalnprtqshaalhstlakkldkkhwkrnpdkncfhceklennfdd
ikhttlgergalreamrclkcadapcqkscpthldiksfitsisnknyygaakmifsdnp
lgltcgmvcptsdlcvggcnlyateegsinigglqqfasevfkamnipqirnpclpsqek
mp

SCOPe Domain Coordinates for d1gthb1:

Click to download the PDB-style file with coordinates for d1gthb1.
(The format of our PDB-style files is described here.)

Timeline for d1gthb1: