Lineage for d1gtha4 (1gth A:184-287,A:441-532)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 176615Fold c.4: Nucleotide-binding domain [51970] (1 superfamily)
  4. 176616Superfamily c.4.1: Nucleotide-binding domain [51971] (3 families) (S)
  5. 176617Family c.4.1.1: N-terminal domain of adrenodoxin reductase-like [51972] (4 proteins)
  6. 176627Protein Dihydropyrimidine dehydrogenase, domain 2 [51977] (1 species)
  7. 176628Species Pig (Sus scrofa) [TaxId:9823] [51978] (5 PDB entries)
  8. 176641Domain d1gtha4: 1gth A:184-287,A:441-532 [70486]
    Other proteins in same PDB: d1gtha1, d1gtha2, d1gtha3, d1gtha5, d1gthb1, d1gthb2, d1gthb3, d1gthb5, d1gthc1, d1gthc2, d1gthc3, d1gthc5, d1gthd1, d1gthd2, d1gthd3, d1gthd5

Details for d1gtha4

PDB Entry: 1gth (more details), 2.25 Å

PDB Description: dihydropyrimidine dehydrogenase (dpd) from pig, ternary complex with nadph and 5-iodouracil

SCOP Domain Sequences for d1gtha4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gtha4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa)}
eaysakiallgagpasiscasflarlgysditifekqeyvgglstseipqfrlpydvvnf
eielmkdlgvkiicgkslseneitlntlkeegykaafigiglpeXvlrdpkvkealspik
fnrwdlpevdpetmqtsepwvfaggdivgmanttvesvndgkqaswyihkyiqaqygasv
sakpelplfytpvdlvd

SCOP Domain Coordinates for d1gtha4:

Click to download the PDB-style file with coordinates for d1gtha4.
(The format of our PDB-style files is described here.)

Timeline for d1gtha4: