Lineage for d1gtfd_ (1gtf D:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 677266Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 677983Superfamily b.82.5: TRAP-like [51219] (2 families) (S)
    shorter variant of double-helix; assembles in large ring-like structures containing from 9 to 11 domains
  5. 677984Family b.82.5.1: Trp RNA-binding attenuation protein (TRAP) [51220] (1 protein)
    oligomeric ring consists of 11 single-domain subunits
  6. 677985Protein Trp RNA-binding attenuation protein (TRAP) [51221] (2 species)
  7. 677986Species Bacillus stearothermophilus [TaxId:1422] [51223] (8 PDB entries)
  8. 677990Domain d1gtfd_: 1gtf D: [70463]

Details for d1gtfd_

PDB Entry: 1gtf (more details), 1.75 Å

PDB Description: the structure of the trp rna-binding attenuation protein (trap) bound to a 53-nucleotide rna molecule containing gaguu repeats
PDB Compounds: (D:) trp RNA-binding attenuation protein (trap)

SCOP Domain Sequences for d1gtfd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gtfd_ b.82.5.1 (D:) Trp RNA-binding attenuation protein (TRAP) {Bacillus stearothermophilus [TaxId: 1422]}
sdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiqtr
hgviesegk

SCOP Domain Coordinates for d1gtfd_:

Click to download the PDB-style file with coordinates for d1gtfd_.
(The format of our PDB-style files is described here.)

Timeline for d1gtfd_: