Lineage for d1gted5 (1gte D:845-1019)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 328742Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 328743Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (5 families) (S)
  5. 328830Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (7 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
  6. 328837Protein Dihydropyrimidine dehydrogenase, C-terminal domain [54891] (1 species)
    includes linker from domain 4
  7. 328838Species Pig (Sus scrofa) [TaxId:9823] [54892] (5 PDB entries)
  8. 328842Domain d1gted5: 1gte D:845-1019 [70459]
    Other proteins in same PDB: d1gtea1, d1gtea2, d1gtea3, d1gtea4, d1gteb1, d1gteb2, d1gteb3, d1gteb4, d1gtec1, d1gtec2, d1gtec3, d1gtec4, d1gted1, d1gted2, d1gted3, d1gted4
    complexed with fad, fmn, fs4, iur

Details for d1gted5

PDB Entry: 1gte (more details), 1.65 Å

PDB Description: dihydropyrimidine dehydrogenase (dpd) from pig, binary complex with 5- iodouracil

SCOP Domain Sequences for d1gted5:

Sequence, based on SEQRES records: (download)

>d1gted5 d.58.1.5 (D:845-1019) Dihydropyrimidine dehydrogenase, C-terminal domain {Pig (Sus scrofa)}
elqgwdgqspgteshqkgkpvpriaelmgkklpnfgpyleqrkkiiaeekmrlkeqnaaf
pplerkpfipkkpipaikdvigkalqylgtfgelsnieqvvavideemcincgkcymtcn
dsgyqaiqfdpethlptvtdtctgctlclsvcpiidcirmvsrttpyepkrglpl

Sequence, based on observed residues (ATOM records): (download)

>d1gted5 d.58.1.5 (D:845-1019) Dihydropyrimidine dehydrogenase, C-terminal domain {Pig (Sus scrofa)}
elqgwdgqspgteshqkgkpvpriaelmgkklpnfgpyleqrkkiiaeekmrlkeqnale
rkpfipkkpipaikdvigkalqylgtfgelsnieqvvavideemcincgkcymtcndsgy
qaiqfdpethlptvtdtctgctlclsvcpiidcirmvsrttpyepkrglpl

SCOP Domain Coordinates for d1gted5:

Click to download the PDB-style file with coordinates for d1gted5.
(The format of our PDB-style files is described here.)

Timeline for d1gted5: