![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.4: Nucleotide-binding domain [51970] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like |
![]() | Superfamily c.4.1: Nucleotide-binding domain [51971] (3 families) ![]() this superfamily shares the common nucleotide-binding site with and provides a link between the Rossmann-fold NAD(P)-binding and FAD/NAD(P)-binding domains |
![]() | Family c.4.1.1: N-terminal domain of adrenodoxin reductase-like [51972] (5 proteins) |
![]() | Protein Dihydropyrimidine dehydrogenase, domain 2 [51977] (1 species) |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [51978] (9 PDB entries) |
![]() | Domain d1gted4: 1gte D:184-287,D:441-532 [70458] Other proteins in same PDB: d1gtea1, d1gtea2, d1gtea3, d1gtea5, d1gteb1, d1gteb2, d1gteb3, d1gteb5, d1gtec1, d1gtec2, d1gtec3, d1gtec5, d1gted1, d1gted2, d1gted3, d1gted5 complexed with fad, fmn, iur, sf4 |
PDB Entry: 1gte (more details), 1.65 Å
SCOPe Domain Sequences for d1gted4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gted4 c.4.1.1 (D:184-287,D:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} eaysakiallgagpasiscasflarlgysditifekqeyvgglstseipqfrlpydvvnf eielmkdlgvkiicgkslseneitlntlkeegykaafigiglpeXvlrdpkvkealspik fnrwdlpevdpetmqtsepwvfaggdivgmanttvesvndgkqaswyihkyiqaqygasv sakpelplfytpvdlvd
Timeline for d1gted4:
![]() Domains from same chain: (mouse over for more information) d1gted1, d1gted2, d1gted3, d1gted5 |