Lineage for d1gted4 (1gte D:184-287,D:441-532)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 389384Fold c.4: Nucleotide-binding domain [51970] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
  4. 389385Superfamily c.4.1: Nucleotide-binding domain [51971] (3 families) (S)
    this superfamily shares the common nucleotide-binding site with and provides a link between the Rossmann-fold NAD(P)-binding and FAD/NAD(P)-binding domains
  5. 389386Family c.4.1.1: N-terminal domain of adrenodoxin reductase-like [51972] (5 proteins)
  6. 389399Protein Dihydropyrimidine dehydrogenase, domain 2 [51977] (1 species)
  7. 389400Species Pig (Sus scrofa) [TaxId:9823] [51978] (5 PDB entries)
  8. 389408Domain d1gted4: 1gte D:184-287,D:441-532 [70458]
    Other proteins in same PDB: d1gtea1, d1gtea2, d1gtea3, d1gtea5, d1gteb1, d1gteb2, d1gteb3, d1gteb5, d1gtec1, d1gtec2, d1gtec3, d1gtec5, d1gted1, d1gted2, d1gted3, d1gted5
    complexed with fad, fmn, fs4, iur

Details for d1gted4

PDB Entry: 1gte (more details), 1.65 Å

PDB Description: dihydropyrimidine dehydrogenase (dpd) from pig, binary complex with 5- iodouracil

SCOP Domain Sequences for d1gted4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gted4 c.4.1.1 (D:184-287,D:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa)}
eaysakiallgagpasiscasflarlgysditifekqeyvgglstseipqfrlpydvvnf
eielmkdlgvkiicgkslseneitlntlkeegykaafigiglpeXvlrdpkvkealspik
fnrwdlpevdpetmqtsepwvfaggdivgmanttvesvndgkqaswyihkyiqaqygasv
sakpelplfytpvdlvd

SCOP Domain Coordinates for d1gted4:

Click to download the PDB-style file with coordinates for d1gted4.
(The format of our PDB-style files is described here.)

Timeline for d1gted4: