SCOP 1.75: Domain d1gted1: 1gte D:2-183

Lineage for d1gted1 (1gte D:2-183)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.2: alpha-helical ferredoxin [46548] (2 families)
   contains two Fe4-S4 clusters

5. Family a.1.2.2: Dihydropyrimidine dehydrogenase, N-terminal domain [46553] (1 protein)

6. Protein Dihydropyrimidine dehydrogenase, N-terminal domain [46554] (1 species)
   includes the N-terminal tail and the linker to domain 2

7. Species Pig (Sus scrofa) [TaxId:9823] [46555] (5 PDB entries)

8. Domain d1gted1: 1gte D:2-183 [70455]
   Other proteins in same PDB: d1gtea2, d1gtea3, d1gtea4, d1gtea5, d1gteb2, d1gteb3, d1gteb4, d1gteb5, d1gtec2, d1gtec3, d1gtec4, d1gtec5, d1gted2, d1gted3, d1gted4, d1gted5
   complexed with fad, fmn, fs4, iur

Details for d1gted1

PDB Entry: 1gte, 1.65 Å

PDB Description: dihydropyrimidine dehydrogenase (dpd) from pig, binary complex with 5- iodouracil

PDB Compounds: (D:) dihydropyrimidine dehydrogenase

SCOP Domain Sequences for d1gted1:

Sequence; same for both SEQRES and ATOM records:

>d1gted1 a.1.2.2 (D:2-183) Dihydropyrimidine dehydrogenase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
apvlskdvadiesilalnprtqshaalhstlakkldkkhwkrnpdkncfhceklennfdd
ikhttlgergalreamrclkcadapcqkscpthldiksfitsisnknyygaakmifsdnp
lgltcgmvcptsdlcvggcnlyateegsinigglqqfasevfkamnipqirnpclpsqek
mp

Timeline for d1gted1:

• d1gted1 first appeared in SCOP 1.61
  
• d1gted1 appears in SCOP 1.73
  
• d1gted1 appears in SCOPe 2.01
  
• d1gted1 appears in the current release, SCOPe 2.08