Lineage for d1gtec5 (1gte C:845-1017)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 603243Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 603244Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (5 families) (S)
  5. 603341Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (9 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
  6. 603348Protein Dihydropyrimidine dehydrogenase, C-terminal domain [54891] (1 species)
    includes linker from domain 4
  7. 603349Species Pig (Sus scrofa) [TaxId:9823] [54892] (5 PDB entries)
  8. 603352Domain d1gtec5: 1gte C:845-1017 [70454]
    Other proteins in same PDB: d1gtea1, d1gtea2, d1gtea3, d1gtea4, d1gteb1, d1gteb2, d1gteb3, d1gteb4, d1gtec1, d1gtec2, d1gtec3, d1gtec4, d1gted1, d1gted2, d1gted3, d1gted4

Details for d1gtec5

PDB Entry: 1gte (more details), 1.65 Å

PDB Description: dihydropyrimidine dehydrogenase (dpd) from pig, binary complex with 5- iodouracil

SCOP Domain Sequences for d1gtec5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gtec5 d.58.1.5 (C:845-1017) Dihydropyrimidine dehydrogenase, C-terminal domain {Pig (Sus scrofa)}
elqgwdgqspgteshqkgkpvpriaelmgkklpnfgpyleqrkkiiaeekmrlkeqnaaf
pplerkpfipkkpipaikdvigkalqylgtfgelsnieqvvavideemcincgkcymtcn
dsgyqaiqfdpethlptvtdtctgctlclsvcpiidcirmvsrttpyepkrgl

SCOP Domain Coordinates for d1gtec5:

Click to download the PDB-style file with coordinates for d1gtec5.
(The format of our PDB-style files is described here.)

Timeline for d1gtec5: