Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.4: Nucleotide-binding domain [51970] (1 superfamily) |
Superfamily c.4.1: Nucleotide-binding domain [51971] (3 families) |
Family c.4.1.1: N-terminal domain of adrenodoxin reductase-like [51972] (4 proteins) |
Protein Dihydropyrimidine dehydrogenase, domain 2 [51977] (1 species) |
Species Pig (Sus scrofa) [TaxId:9823] [51978] (5 PDB entries) |
Domain d1gtec4: 1gte C:184-287,C:441-532 [70453] Other proteins in same PDB: d1gtea1, d1gtea2, d1gtea3, d1gtea5, d1gteb1, d1gteb2, d1gteb3, d1gteb5, d1gtec1, d1gtec2, d1gtec3, d1gtec5, d1gted1, d1gted2, d1gted3, d1gted5 |
PDB Entry: 1gte (more details), 1.65 Å
SCOP Domain Sequences for d1gtec4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gtec4 c.4.1.1 (C:184-287,C:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa)} eaysakiallgagpasiscasflarlgysditifekqeyvgglstseipqfrlpydvvnf eielmkdlgvkiicgkslseneitlntlkeegykaafigiglpeXvlrdpkvkealspik fnrwdlpevdpetmqtsepwvfaggdivgmanttvesvndgkqaswyihkyiqaqygasv sakpelplfytpvdlvd
Timeline for d1gtec4:
View in 3D Domains from same chain: (mouse over for more information) d1gtec1, d1gtec2, d1gtec3, d1gtec5 |