Lineage for d1gteb5 (1gte B:845-1018)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949055Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 2949232Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 2949247Protein Dihydropyrimidine dehydrogenase, C-terminal domain [54891] (1 species)
    includes linker from domain 4
  7. 2949248Species Pig (Sus scrofa) [TaxId:9823] [54892] (9 PDB entries)
  8. 2949258Domain d1gteb5: 1gte B:845-1018 [70449]
    Other proteins in same PDB: d1gtea1, d1gtea2, d1gtea3, d1gtea4, d1gteb1, d1gteb2, d1gteb3, d1gteb4, d1gtec1, d1gtec2, d1gtec3, d1gtec4, d1gted1, d1gted2, d1gted3, d1gted4
    complexed with fad, fmn, iur, sf4

Details for d1gteb5

PDB Entry: 1gte (more details), 1.65 Å

PDB Description: dihydropyrimidine dehydrogenase (dpd) from pig, binary complex with 5- iodouracil
PDB Compounds: (B:) dihydropyrimidine dehydrogenase

SCOPe Domain Sequences for d1gteb5:

Sequence, based on SEQRES records: (download)

>d1gteb5 d.58.1.5 (B:845-1018) Dihydropyrimidine dehydrogenase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
elqgwdgqspgteshqkgkpvpriaelmgkklpnfgpyleqrkkiiaeekmrlkeqnaaf
pplerkpfipkkpipaikdvigkalqylgtfgelsnieqvvavideemcincgkcymtcn
dsgyqaiqfdpethlptvtdtctgctlclsvcpiidcirmvsrttpyepkrglp

Sequence, based on observed residues (ATOM records): (download)

>d1gteb5 d.58.1.5 (B:845-1018) Dihydropyrimidine dehydrogenase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
elqgwdgqspgteshqkgkpvpriaelmgkklpnfgpyleqrkkiiaeekmrlkeqnerk
pfipkkpipaikdvigkalqylgtfgelsnieqvvavideemcincgkcymtcndsgyqa
iqfdpethlptvtdtctgctlclsvcpiidcirmvsrttpyepkrglp

SCOPe Domain Coordinates for d1gteb5:

Click to download the PDB-style file with coordinates for d1gteb5.
(The format of our PDB-style files is described here.)

Timeline for d1gteb5: