Lineage for d1gteb3 (1gte B:288-440)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) 
Family c.3.1.1: C-terminal domain of adrenodoxin reductase-like [51906] (4 proteins) 
Protein Dihydropyrimidine dehydrogenase, domain 3 [51911] (1 species) Species Pig (Sus scrofa) [TaxId:9823] [51912] (5 PDB entries) 
Domain d1gteb3: 1gte B:288-440 [70447]
Other proteins in same PDB: d1gtea1, d1gtea2, d1gtea4, d1gtea5, d1gteb1, d1gteb2, d1gteb4, d1gteb5, d1gtec1, d1gtec2, d1gtec4, d1gtec5, d1gted1, d1gted2, d1gted4, d1gted5
Details for d1gteb3
PDB Entry: 1gte (more details), 1.65 Å
PDB Description: dihydropyrimidine dehydrogenase (dpd) from pig, binary complex with 5- iodouracil
SCOP Domain Sequences for d1gteb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gteb3 c.3.1.1 (B:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa)}
pktddifqgltqdqgfytskdflplvaksskagmcachsplpsirgavivlgagdtafdc
atsalrcgarrvflvfrkgfvniravpeevelakeekceflpflsprkvivkggrivavq
fvrteqdetgkwnededqivhlkadvvisafgs
SCOP Domain Coordinates for d1gteb3:
Click to download the PDB-style file with coordinates for d1gteb3.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gteb3:
- d1gteb3 is new in SCOP 1.61
- d1gteb3 appears in SCOP 1.63
- d1gteb3 appears in the current release, SCOPe 2.08
 View in 3DDomains from same chain: (mouse over for more information) d1gteb1, d1gteb2, d1gteb4, d1gteb5 |
