Lineage for d1gteb1 (1gte B:2-183)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1979697Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) (S)
    contains two Fe4-S4 clusters
  5. 1979778Family a.1.2.2: Dihydropyrimidine dehydrogenase, N-terminal domain [46553] (1 protein)
  6. 1979779Protein Dihydropyrimidine dehydrogenase, N-terminal domain [46554] (1 species)
    includes the N-terminal tail and the linker to domain 2
  7. 1979780Species Pig (Sus scrofa) [TaxId:9823] [46555] (5 PDB entries)
  8. 1979782Domain d1gteb1: 1gte B:2-183 [70445]
    Other proteins in same PDB: d1gtea2, d1gtea3, d1gtea4, d1gtea5, d1gteb2, d1gteb3, d1gteb4, d1gteb5, d1gtec2, d1gtec3, d1gtec4, d1gtec5, d1gted2, d1gted3, d1gted4, d1gted5
    complexed with fad, fmn, iur, sf4

Details for d1gteb1

PDB Entry: 1gte (more details), 1.65 Å

PDB Description: dihydropyrimidine dehydrogenase (dpd) from pig, binary complex with 5- iodouracil
PDB Compounds: (B:) dihydropyrimidine dehydrogenase

SCOPe Domain Sequences for d1gteb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gteb1 a.1.2.2 (B:2-183) Dihydropyrimidine dehydrogenase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
apvlskdvadiesilalnprtqshaalhstlakkldkkhwkrnpdkncfhceklennfdd
ikhttlgergalreamrclkcadapcqkscpthldiksfitsisnknyygaakmifsdnp
lgltcgmvcptsdlcvggcnlyateegsinigglqqfasevfkamnipqirnpclpsqek
mp

SCOPe Domain Coordinates for d1gteb1:

Click to download the PDB-style file with coordinates for d1gteb1.
(The format of our PDB-style files is described here.)

Timeline for d1gteb1: