Class a: All alpha proteins [46456] (202 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.2: alpha-helical ferredoxin [46548] (2 families) contains two Fe4-S4 clusters |
Family a.1.2.2: Dihydropyrimidine dehydrogenase, N-terminal domain [46553] (1 protein) |
Protein Dihydropyrimidine dehydrogenase, N-terminal domain [46554] (1 species) includes the N-terminal tail and the linker to domain 2 |
Species Pig (Sus scrofa) [TaxId:9823] [46555] (5 PDB entries) |
Domain d1gteb1: 1gte B:2-183 [70445] Other proteins in same PDB: d1gtea2, d1gtea3, d1gtea4, d1gtea5, d1gteb2, d1gteb3, d1gteb4, d1gteb5, d1gtec2, d1gtec3, d1gtec4, d1gtec5, d1gted2, d1gted3, d1gted4, d1gted5 |
PDB Entry: 1gte (more details), 1.65 Å
SCOP Domain Sequences for d1gteb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gteb1 a.1.2.2 (B:2-183) Dihydropyrimidine dehydrogenase, N-terminal domain {Pig (Sus scrofa)} apvlskdvadiesilalnprtqshaalhstlakkldkkhwkrnpdkncfhceklennfdd ikhttlgergalreamrclkcadapcqkscpthldiksfitsisnknyygaakmifsdnp lgltcgmvcptsdlcvggcnlyateegsinigglqqfasevfkamnipqirnpclpsqek mp
Timeline for d1gteb1:
View in 3D Domains from same chain: (mouse over for more information) d1gteb2, d1gteb3, d1gteb4, d1gteb5 |