Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) |
Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins) members of this "family" may be more closely related to other ferredoxins than to each other |
Protein Dihydropyrimidine dehydrogenase, C-terminal domain [54891] (1 species) includes linker from domain 4 |
Species Pig (Sus scrofa) [TaxId:9823] [54892] (5 PDB entries) |
Domain d1gtea5: 1gte A:845-1017 [70444] Other proteins in same PDB: d1gtea1, d1gtea2, d1gtea3, d1gtea4, d1gteb1, d1gteb2, d1gteb3, d1gteb4, d1gtec1, d1gtec2, d1gtec3, d1gtec4, d1gted1, d1gted2, d1gted3, d1gted4 complexed with fad, fmn, iur, sf4 |
PDB Entry: 1gte (more details), 1.65 Å
SCOPe Domain Sequences for d1gtea5:
Sequence, based on SEQRES records: (download)
>d1gtea5 d.58.1.5 (A:845-1017) Dihydropyrimidine dehydrogenase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} elqgwdgqspgteshqkgkpvpriaelmgkklpnfgpyleqrkkiiaeekmrlkeqnaaf pplerkpfipkkpipaikdvigkalqylgtfgelsnieqvvavideemcincgkcymtcn dsgyqaiqfdpethlptvtdtctgctlclsvcpiidcirmvsrttpyepkrgl
>d1gtea5 d.58.1.5 (A:845-1017) Dihydropyrimidine dehydrogenase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} elqgwdgqspgteshqkgkpvpriaelmgkklpnfgpyleqrkkiiaeekmrlkeqnerk pfipkkpipaikdvigkalqylgtfgelsnieqvvavideemcincgkcymtcndsgyqa iqfdpethlptvtdtctgctlclsvcpiidcirmvsrttpyepkrgl
Timeline for d1gtea5:
View in 3D Domains from same chain: (mouse over for more information) d1gtea1, d1gtea2, d1gtea3, d1gtea4 |