Lineage for d1gt8d4 (1gt8 D:184-287,D:441-532)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1155041Fold c.4: Nucleotide-binding domain [51970] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
  4. 1155042Superfamily c.4.1: Nucleotide-binding domain [51971] (3 families) (S)
    this superfamily shares the common nucleotide-binding site with and provides a link between the Rossmann-fold NAD(P)-binding and FAD/NAD(P)-binding domains
  5. 1155043Family c.4.1.1: N-terminal domain of adrenodoxin reductase-like [51972] (5 proteins)
  6. 1155056Protein Dihydropyrimidine dehydrogenase, domain 2 [51977] (1 species)
  7. 1155057Species Pig (Sus scrofa) [TaxId:9823] [51978] (5 PDB entries)
  8. 1155077Domain d1gt8d4: 1gt8 D:184-287,D:441-532 [70436]
    Other proteins in same PDB: d1gt8a1, d1gt8a2, d1gt8a3, d1gt8a5, d1gt8b1, d1gt8b2, d1gt8b3, d1gt8b5, d1gt8c1, d1gt8c2, d1gt8c3, d1gt8c5, d1gt8d1, d1gt8d2, d1gt8d3, d1gt8d5
    complexed with fad, fmn, ndp, sf4, uaa

Details for d1gt8d4

PDB Entry: 1gt8 (more details), 3.3 Å

PDB Description: dihydropyrimidine dehydrogenase (dpd) from pig, ternary complex with nadph and uracil-4-acetic acid
PDB Compounds: (D:) dihydropyrimidine dehydrogenase

SCOPe Domain Sequences for d1gt8d4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gt8d4 c.4.1.1 (D:184-287,D:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]}
eaysakiallgagpasiscasflarlgysditifekqeyvgglstseipqfrlpydvvnf
eielmkdlgvkiicgkslseneitlntlkeegykaafigiglpeXvlrdpkvkealspik
fnrwdlpevdpetmqtsepwvfaggdivgmanttvesvndgkqaswyihkyiqaqygasv
sakpelplfytpvdlvd

SCOPe Domain Coordinates for d1gt8d4:

Click to download the PDB-style file with coordinates for d1gt8d4.
(The format of our PDB-style files is described here.)

Timeline for d1gt8d4: