| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.2: alpha-helical ferredoxin [46548] (2 families) ![]() contains two Fe4-S4 clusters |
| Family a.1.2.2: Dihydropyrimidine dehydrogenase, N-terminal domain [46553] (1 protein) |
| Protein Dihydropyrimidine dehydrogenase, N-terminal domain [46554] (1 species) includes the N-terminal tail and the linker to domain 2 |
| Species Pig (Sus scrofa) [TaxId:9823] [46555] (5 PDB entries) |
| Domain d1gt8d1: 1gt8 D:2-183 [70433] Other proteins in same PDB: d1gt8a2, d1gt8a3, d1gt8a4, d1gt8a5, d1gt8b2, d1gt8b3, d1gt8b4, d1gt8b5, d1gt8c2, d1gt8c3, d1gt8c4, d1gt8c5, d1gt8d2, d1gt8d3, d1gt8d4, d1gt8d5 complexed with fad, fmn, ndp, sf4, uaa |
PDB Entry: 1gt8 (more details), 3.3 Å
SCOPe Domain Sequences for d1gt8d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gt8d1 a.1.2.2 (D:2-183) Dihydropyrimidine dehydrogenase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
apvlskdvadiesilalnprtqshaalhstlakkldkkhwkrnpdkncfhceklennfdd
ikhttlgergalreamrclkcadapcqkscpthldiksfitsisnknyygaakmifsdnp
lgltcgmvcptsdlcvggcnlyateegsinigglqqfasevfkamnipqirnpclpsqek
mp
Timeline for d1gt8d1:
View in 3DDomains from same chain: (mouse over for more information) d1gt8d2, d1gt8d3, d1gt8d4, d1gt8d5 |