Lineage for d1gt8c3 (1gt8 C:288-440)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 176176Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
  4. 176177Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 176178Family c.3.1.1: C-terminal domain of adrenodoxin reductase-like [51906] (4 proteins)
  6. 176188Protein Dihydropyrimidine dehydrogenase, domain 3 [51911] (1 species)
  7. 176189Species Pig (Sus scrofa) [TaxId:9823] [51912] (5 PDB entries)
  8. 176208Domain d1gt8c3: 1gt8 C:288-440 [70430]
    Other proteins in same PDB: d1gt8a1, d1gt8a2, d1gt8a4, d1gt8a5, d1gt8b1, d1gt8b2, d1gt8b4, d1gt8b5, d1gt8c1, d1gt8c2, d1gt8c4, d1gt8c5, d1gt8d1, d1gt8d2, d1gt8d4, d1gt8d5

Details for d1gt8c3

PDB Entry: 1gt8 (more details), 3.3 Å

PDB Description: dihydropyrimidine dehydrogenase (dpd) from pig, ternary complex with nadph and uracil-4-acetic acid

SCOP Domain Sequences for d1gt8c3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gt8c3 c.3.1.1 (C:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa)}
pktddifqgltqdqgfytskdflplvaksskagmcachsplpsirgavivlgagdtafdc
atsalrcgarrvflvfrkgfvniravpeevelakeekceflpflsprkvivkggrivavq
fvrteqdetgkwnededqivhlkadvvisafgs

SCOP Domain Coordinates for d1gt8c3:

Click to download the PDB-style file with coordinates for d1gt8c3.
(The format of our PDB-style files is described here.)

Timeline for d1gt8c3: