Lineage for d1gt8c2 (1gt8 C:533-844)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 172678Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies)
  4. 172977Superfamily c.1.4: FMN-linked oxidoreductases [51395] (1 family) (S)
  5. 172978Family c.1.4.1: FMN-linked oxidoreductases [51396] (11 proteins)
  6. 173008Protein Dihydropyrimidine dehydrogenase, domain 4 [51410] (1 species)
  7. 173009Species Pig (Sus scrofa) [TaxId:9823] [51411] (5 PDB entries)
  8. 173028Domain d1gt8c2: 1gt8 C:533-844 [70429]
    Other proteins in same PDB: d1gt8a1, d1gt8a3, d1gt8a4, d1gt8a5, d1gt8b1, d1gt8b3, d1gt8b4, d1gt8b5, d1gt8c1, d1gt8c3, d1gt8c4, d1gt8c5, d1gt8d1, d1gt8d3, d1gt8d4, d1gt8d5

Details for d1gt8c2

PDB Entry: 1gt8 (more details), 3.3 Å

PDB Description: dihydropyrimidine dehydrogenase (dpd) from pig, ternary complex with nadph and uracil-4-acetic acid

SCOP Domain Sequences for d1gt8c2:

Sequence, based on SEQRES records: (download)

>d1gt8c2 c.1.4.1 (C:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa)}
isvemaglkfinpfglasaapttsssmirrafeagwgfaltktfsldkdivtnvsprivr
gttsgpmygpgqssflnielisektaaywcqsvtelkadfpdniviasimcsynkndwme
lsrkaeasgadalelnlscphgmgergmglacgqdpelvrnicrwvrqavqipffakltp
nvtdivsiaraakeggadgvtatntvsglmglkadgtpwpavgagkrttyggvsgtairp
ialravttiaralpgfpilatggidsaesglqflhsgasvlqvcsavqnqdftviqdyct
glkallylksie

Sequence, based on observed residues (ATOM records): (download)

>d1gt8c2 c.1.4.1 (C:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa)}
isvemaglkfinpfglasaapttsssmirrafeagwgfaltktfsldkdivtnvsprivr
gttsgpmygpgqssflnielisektaaywcqsvtelkadfpdniviasimcsynkndwme
lsrkaeasgadalelnlscplacgqdpelvrnicrwvrqavqipffakltpnvtdivsia
raakeggadgvtatntvsglmglkadgtpwpavgagkrttyggvsgtairpialravtti
aralpgfpilatggidsaesglqflhsgasvlqvcsavqnqdftviqdyctglkallylk
sie

SCOP Domain Coordinates for d1gt8c2:

Click to download the PDB-style file with coordinates for d1gt8c2.
(The format of our PDB-style files is described here.)

Timeline for d1gt8c2: