SCOPe 2.04: Domain d1gt8b4: 1gt8 B:184-287,B:441-532

Lineage for d1gt8b4 (1gt8 B:184-287,B:441-532)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.4: Nucleotide-binding domain [51970] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like

4. Superfamily c.4.1: Nucleotide-binding domain [51971] (3 families)
   this superfamily shares the common nucleotide-binding site with and provides a link between the Rossmann-fold NAD(P)-binding and FAD/NAD(P)-binding domains

5. Family c.4.1.1: N-terminal domain of adrenodoxin reductase-like [51972] (5 proteins)

6. Protein Dihydropyrimidine dehydrogenase, domain 2 [51977] (1 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [51978] (5 PDB entries)

8. Domain d1gt8b4: 1gt8 B:184-287,B:441-532 [70426]
   Other proteins in same PDB: d1gt8a1, d1gt8a2, d1gt8a3, d1gt8a5, d1gt8b1, d1gt8b2, d1gt8b3, d1gt8b5, d1gt8c1, d1gt8c2, d1gt8c3, d1gt8c5, d1gt8d1, d1gt8d2, d1gt8d3, d1gt8d5
   complexed with fad, fmn, ndp, sf4, uaa

Details for d1gt8b4

PDB Entry: 1gt8, 3.3 Å

PDB Description: dihydropyrimidine dehydrogenase (dpd) from pig, ternary complex with nadph and uracil-4-acetic acid

PDB Compounds: (B:) dihydropyrimidine dehydrogenase

SCOPe Domain Sequences for d1gt8b4:

Sequence; same for both SEQRES and ATOM records:

>d1gt8b4 c.4.1.1 (B:184-287,B:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]}
eaysakiallgagpasiscasflarlgysditifekqeyvgglstseipqfrlpydvvnf
eielmkdlgvkiicgkslseneitlntlkeegykaafigiglpeXvlrdpkvkealspik
fnrwdlpevdpetmqtsepwvfaggdivgmanttvesvndgkqaswyihkyiqaqygasv
sakpelplfytpvdlvd

Timeline for d1gt8b4:

• d1gt8b4 first appeared in SCOP 1.61
  
• d1gt8b4 appears in SCOPe 2.03
  
• d1gt8b4 appears in SCOPe 2.05
  
• d1gt8b4 appears in the current release, SCOPe 2.08