Lineage for d1gt7t_ (1gt7 T:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2155368Fold c.74: AraD/HMP-PK domain-like [53638] (1 superfamily)
    3 layers: a/b/a; mixed (mostly antiparallel) beta-sheet of 9 strands, order 432159876; left-handed crossover between strands 4 and 5
  4. 2155369Superfamily c.74.1: AraD/HMP-PK domain-like [53639] (3 families) (S)
  5. 2155370Family c.74.1.1: AraD-like aldolase/epimerase [53640] (5 proteins)
    metal (zinc)-ion dependent
  6. 2155390Protein L-rhamnulose-1-phosphate aldolase [75301] (1 species)
  7. 2155391Species Escherichia coli [TaxId:562] [75302] (8 PDB entries)
  8. 2155427Domain d1gt7t_: 1gt7 T: [70417]
    complexed with pgh, zn

Details for d1gt7t_

PDB Entry: 1gt7 (more details), 2.7 Å

PDB Description: l-rhamnulose-1-phosphate aldolase from escherichia coli
PDB Compounds: (T:) rhamnulose-1-phosphate aldolase

SCOPe Domain Sequences for d1gt7t_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gt7t_ c.74.1.1 (T:) L-rhamnulose-1-phosphate aldolase {Escherichia coli [TaxId: 562]}
mqnitqswfvqgmikattdawlkgwdernggnltlrlddadiapyhdnfhqqpryiplsq
pmpllantpfivtgsgkffrnvqldpaanlgivkvdsdgagyhilwgltneavptselpa
hflshcerikatngkdrvimhchatnlialtyvlendtavftrqlwegsteclvvfpdgv
gilpwmvpgtdeigqataqemqkhslvlwpfhgvfgsgptldetfglidtaeksaqvlvk
vysmggmkqtisreelialgkrfgvtplasalal

SCOPe Domain Coordinates for d1gt7t_:

Click to download the PDB-style file with coordinates for d1gt7t_.
(The format of our PDB-style files is described here.)

Timeline for d1gt7t_: