Lineage for d1gt7q_ (1gt7 Q:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 401724Fold c.74: AraD-like aldolase/epimerase [53638] (1 superfamily)
    3 layers: a/b/a; mixed (mostly antiparallel) beta-sheet of 9 strands, order 432159876; left-handed crossover between strands 4 and 5
  4. 401725Superfamily c.74.1: AraD-like aldolase/epimerase [53639] (1 family) (S)
  5. 401726Family c.74.1.1: AraD-like aldolase/epimerase [53640] (4 proteins)
    metal (zinc)-ion dependent
  6. 401746Protein L-rhamnulose-1-phosphate aldolase [75301] (1 species)
  7. 401747Species Escherichia coli [TaxId:562] [75302] (2 PDB entries)
  8. 401765Domain d1gt7q_: 1gt7 Q: [70414]

Details for d1gt7q_

PDB Entry: 1gt7 (more details), 2.7 Å

PDB Description: l-rhamnulose-1-phosphate aldolase from escherichia coli

SCOP Domain Sequences for d1gt7q_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gt7q_ c.74.1.1 (Q:) L-rhamnulose-1-phosphate aldolase {Escherichia coli}
mqnitqswfvqgmikattdawlkgwdernggnltlrlddadiapyhdnfhqqpryiplsq
pmpllantpfivtgsgkffrnvqldpaanlgivkvdsdgagyhilwgltneavptselpa
hflshcerikatngkdrvimhchatnlialtyvlendtavftrqlwegsteclvvfpdgv
gilpwmvpgtdeigqataqemqkhslvlwpfhgvfgsgptldetfglidtaeksaqvlvk
vysmggmkqtisreelialgkrfgvtplasalal

SCOP Domain Coordinates for d1gt7q_:

Click to download the PDB-style file with coordinates for d1gt7q_.
(The format of our PDB-style files is described here.)

Timeline for d1gt7q_: