Lineage for d1gsia_ (1gsi A:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 179162Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 179163Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) (S)
  5. 179164Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (15 proteins)
  6. 179299Protein Thymidylate kinase [52563] (4 species)
  7. 179330Species Mycobacterium tuberculosis [TaxId:1773] [69482] (3 PDB entries)
  8. 179331Domain d1gsia_: 1gsi A: [70396]

Details for d1gsia_

PDB Entry: 1gsi (more details), 1.6 Å

PDB Description: crystal structure of mycobacterium tuberculosis thymidylate kinase complexed with thymidine monophosphate (tmp)

SCOP Domain Sequences for d1gsia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis}
mliaiegvdgagkrtlveklsgafraagrsvatlafprygqsvaadiaaealhgehgdla
ssvyamatlfaldragavhtiqglcrgydvvildryvasnaaysaarlhenaagkaaawv
qriefarlglpkpdwqvllavsaelagersrgraqrdpgrardnyerdaelqqrtgavya
elaaqgwggrwlvvgadvdpgrlaatla

SCOP Domain Coordinates for d1gsia_:

Click to download the PDB-style file with coordinates for d1gsia_.
(The format of our PDB-style files is described here.)

Timeline for d1gsia_: