Lineage for d1grwd_ (1grw D:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 788734Superfamily b.1.11: PapD-like [49354] (2 families) (S)
    contains PP switch between strands D and C'
  5. 788801Family b.1.11.2: MSP-like [49360] (4 proteins)
    Pfam PF00635
  6. 788802Protein Major sperm protein, MSP [49361] (2 species)
  7. 788803Species Nematode (Caenorhabditis elegans) [TaxId:6239] [74862] (1 PDB entry)
  8. 788807Domain d1grwd_: 1grw D: [70394]

Details for d1grwd_

PDB Entry: 1grw (more details), 2.6 Å

PDB Description: c. elegans major sperm protein
PDB Compounds: (D:) major sperm protein 31/40/142

SCOP Domain Sequences for d1grwd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1grwd_ b.1.11.2 (D:) Major sperm protein, MSP {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
svppgdiqtqpgtkivfnapyddkhtyhikvinssarrigygikttnmkrlgvdppcgvl
dpkeavllavscdafafgqedtnndritvewtntpdgaakqfrrewfqgdgmvrrknlpi
eynp

SCOP Domain Coordinates for d1grwd_:

Click to download the PDB-style file with coordinates for d1grwd_.
(The format of our PDB-style files is described here.)

Timeline for d1grwd_: