Class b: All beta proteins [48724] (149 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.11: PapD-like [49354] (2 families) contains PP switch between strands D and C' |
Family b.1.11.2: MSP-like [49360] (4 proteins) Pfam 00635 |
Protein Major sperm protein, MSP [49361] (2 species) |
Species Nematode (Caenorhabditis elegans) [TaxId:6239] [74862] (1 PDB entry) |
Domain d1grwd_: 1grw D: [70394] |
PDB Entry: 1grw (more details), 2.6 Å
SCOP Domain Sequences for d1grwd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1grwd_ b.1.11.2 (D:) Major sperm protein, MSP {Nematode (Caenorhabditis elegans)} svppgdiqtqpgtkivfnapyddkhtyhikvinssarrigygikttnmkrlgvdppcgvl dpkeavllavscdafafgqedtnndritvewtntpdgaakqfrrewfqgdgmvrrknlpi eynp
Timeline for d1grwd_: