Lineage for d1grwc_ (1grw C:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 937239Superfamily b.1.11: PapD-like [49354] (2 families) (S)
    contains PP switch between strands D and C'
  5. 937306Family b.1.11.2: MSP-like [49360] (4 proteins)
    Pfam PF00635
  6. 937307Protein Major sperm protein, MSP [49361] (2 species)
  7. 937308Species Nematode (Caenorhabditis elegans) [TaxId:6239] [74862] (1 PDB entry)
  8. 937311Domain d1grwc_: 1grw C: [70393]

Details for d1grwc_

PDB Entry: 1grw (more details), 2.6 Å

PDB Description: c. elegans major sperm protein
PDB Compounds: (C:) major sperm protein 31/40/142

SCOPe Domain Sequences for d1grwc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1grwc_ b.1.11.2 (C:) Major sperm protein, MSP {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
svppgdiqtqpgtkivfnapyddkhtyhikvinssarrigygikttnmkrlgvdppcgvl
dpkeavllavscdafafgqedtnndritvewtntpdgaakqfrrewfqgdgmvrrknlpi
eynp

SCOPe Domain Coordinates for d1grwc_:

Click to download the PDB-style file with coordinates for d1grwc_.
(The format of our PDB-style files is described here.)

Timeline for d1grwc_: