Lineage for d1grwc_ (1grw C:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 161647Superfamily b.1.11: PapD-like [49354] (2 families) (S)
  5. 161688Family b.1.11.2: Major sperm protein [49360] (1 protein)
  6. 161689Protein Major sperm protein [49361] (2 species)
  7. 161690Species C.elegans (Caenorhabditis elegans) [74862] (1 PDB entry)
  8. 161693Domain d1grwc_: 1grw C: [70393]

Details for d1grwc_

PDB Entry: 1grw (more details), 2.6 Å

PDB Description: c. elegans major sperm protein

SCOP Domain Sequences for d1grwc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1grwc_ b.1.11.2 (C:) Major sperm protein {C.elegans (Caenorhabditis elegans)}
svppgdiqtqpgtkivfnapyddkhtyhikvinssarrigygikttnmkrlgvdppcgvl
dpkeavllavscdafafgqedtnndritvewtntpdgaakqfrrewfqgdgmvrrknlpi
eynp

SCOP Domain Coordinates for d1grwc_:

Click to download the PDB-style file with coordinates for d1grwc_.
(The format of our PDB-style files is described here.)

Timeline for d1grwc_: