Lineage for d1grwa_ (1grw A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 658361Superfamily b.1.11: PapD-like [49354] (2 families) (S)
    contains PP switch between strands D and C'
  5. 658423Family b.1.11.2: MSP-like [49360] (4 proteins)
    Pfam PF00635
  6. 658424Protein Major sperm protein, MSP [49361] (2 species)
  7. 658425Species Nematode (Caenorhabditis elegans) [TaxId:6239] [74862] (1 PDB entry)
  8. 658426Domain d1grwa_: 1grw A: [70391]

Details for d1grwa_

PDB Entry: 1grw (more details), 2.6 Å

PDB Description: c. elegans major sperm protein
PDB Compounds: (A:) major sperm protein 31/40/142

SCOP Domain Sequences for d1grwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1grwa_ b.1.11.2 (A:) Major sperm protein, MSP {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
svppgdiqtqpgtkivfnapyddkhtyhikvinssarrigygikttnmkrlgvdppcgvl
dpkeavllavscdafafgqedtnndritvewtntpdgaakqfrrewfqgdgmvrrknlpi
eynp

SCOP Domain Coordinates for d1grwa_:

Click to download the PDB-style file with coordinates for d1grwa_.
(The format of our PDB-style files is described here.)

Timeline for d1grwa_: