Lineage for d1gr7b_ (1gr7 B:)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) Superfamily b.6.1: Cupredoxins [49503] (5 families) 
Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins) 
Protein Azurin [49530] (6 species) Species Pseudomonas aeruginosa [TaxId:287] [49533] (32 PDB entries) 
Domain d1gr7b_: 1gr7 B: [70382]
Details for d1gr7b_
PDB Entry: 1gr7 (more details), 1.8 Å
PDB Description: crystal structure of the double mutant cys3ser/ser100pro from pseudomonas aeruginosa at 1.8 a resolution
SCOP Domain Sequences for d1gr7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gr7b_ b.6.1.1 (B:) Azurin {Pseudomonas aeruginosa}
ssvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvvtd
gmasgldkdylkpddsrviahtkligsgekdsvtfdvpklkegeqymffctfpghsalmk
gtltlk
SCOP Domain Coordinates for d1gr7b_:
Click to download the PDB-style file with coordinates for d1gr7b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gr7b_:
- d1gr7b_ is new in SCOP 1.61
- d1gr7b_ appears in SCOP 1.63
- d1gr7b_ appears in the current release, SCOPe 2.08
View in 3D
