Lineage for d1gr0a1 (1gr0 A:14-200,A:312-367)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 307887Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 307888Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 308470Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (13 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 308735Protein Myo-inositol 1-phosphate synthase [75105] (2 species)
  7. 308757Species Mycobacterium tuberculosis [TaxId:1773] [75106] (1 PDB entry)
  8. 308758Domain d1gr0a1: 1gr0 A:14-200,A:312-367 [70379]
    Other proteins in same PDB: d1gr0a2
    complexed with cac, nad, zn

Details for d1gr0a1

PDB Entry: 1gr0 (more details), 1.95 Å

PDB Description: myo-inositol 1-phosphate synthase from mycobacterium tuberculosis in complex with nad and zinc.

SCOP Domain Sequences for d1gr0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gr0a1 c.2.1.3 (A:14-200,A:312-367) Myo-inositol 1-phosphate synthase {Mycobacterium tuberculosis}
tevrvaivgvgncasslvqgveyyynaddtstvpglmhvrfgpyhvrdvkfvaafdvdak
kvgfdlsdaifasenntikiadvaptnvivqrgptldgigkyyadtielsdaepvdvvqa
lkeakvdvlvsylpvgseeadkfyaqcaidagvafvnalpvfiasdpvwakkftdarvpi
vgddiksXpnsagviidavraakiakdrgiggpvipasaylmksppeqlpddiaraqlee
fiig

SCOP Domain Coordinates for d1gr0a1:

Click to download the PDB-style file with coordinates for d1gr0a1.
(The format of our PDB-style files is described here.)

Timeline for d1gr0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gr0a2