Lineage for d1gr0a1 (1gr0 A:14-200,A:312-367)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 175017Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 175018Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) (S)
  5. 175469Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (12 proteins)
  6. 175692Protein Myo-inositol 1-phosphate synthase [75105] (2 species)
  7. 175702Species Mycobacterium tuberculosis [TaxId:1773] [75106] (1 PDB entry)
  8. 175703Domain d1gr0a1: 1gr0 A:14-200,A:312-367 [70379]
    Other proteins in same PDB: d1gr0a2

Details for d1gr0a1

PDB Entry: 1gr0 (more details), 1.95 Å

PDB Description: myo-inositol 1-phosphate synthase from mycobacterium tuberculosis in complex with nad and zinc.

SCOP Domain Sequences for d1gr0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gr0a1 c.2.1.3 (A:14-200,A:312-367) Myo-inositol 1-phosphate synthase {Mycobacterium tuberculosis}
tevrvaivgvgncasslvqgveyyynaddtstvpglmhvrfgpyhvrdvkfvaafdvdak
kvgfdlsdaifasenntikiadvaptnvivqrgptldgigkyyadtielsdaepvdvvqa
lkeakvdvlvsylpvgseeadkfyaqcaidagvafvnalpvfiasdpvwakkftdarvpi
vgddiksXpnsagviidavraakiakdrgiggpvipasaylmksppeqlpddiaraqlee
fiig

SCOP Domain Coordinates for d1gr0a1:

Click to download the PDB-style file with coordinates for d1gr0a1.
(The format of our PDB-style files is described here.)

Timeline for d1gr0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gr0a2