Lineage for d1gr0a1 (1gr0 A:14-200,A:312-367)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2843543Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 2844066Protein Myo-inositol 1-phosphate synthase [75105] (4 species)
  7. 2844097Species Mycobacterium tuberculosis [TaxId:1773] [75106] (1 PDB entry)
  8. 2844098Domain d1gr0a1: 1gr0 A:14-200,A:312-367 [70379]
    Other proteins in same PDB: d1gr0a2
    complexed with cac, nad, zn
    has additional insertions and/or extensions that are not grouped together

Details for d1gr0a1

PDB Entry: 1gr0 (more details), 1.95 Å

PDB Description: myo-inositol 1-phosphate synthase from mycobacterium tuberculosis in complex with nad and zinc.
PDB Compounds: (A:) Inositol-3-phosphate synthase

SCOPe Domain Sequences for d1gr0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gr0a1 c.2.1.3 (A:14-200,A:312-367) Myo-inositol 1-phosphate synthase {Mycobacterium tuberculosis [TaxId: 1773]}
tevrvaivgvgncasslvqgveyyynaddtstvpglmhvrfgpyhvrdvkfvaafdvdak
kvgfdlsdaifasenntikiadvaptnvivqrgptldgigkyyadtielsdaepvdvvqa
lkeakvdvlvsylpvgseeadkfyaqcaidagvafvnalpvfiasdpvwakkftdarvpi
vgddiksXpnsagviidavraakiakdrgiggpvipasaylmksppeqlpddiaraqlee
fiig

SCOPe Domain Coordinates for d1gr0a1:

Click to download the PDB-style file with coordinates for d1gr0a1.
(The format of our PDB-style files is described here.)

Timeline for d1gr0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gr0a2