Class b: All beta proteins [48724] (177 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
Family b.82.2.5: TauD/TfdA-like [75038] (5 proteins) automatically mapped to Pfam PF02668 |
Protein Taurine/alpha-ketoglutarate dioxygenase TauD [75039] (1 species) |
Species Escherichia coli [TaxId:562] [75040] (4 PDB entries) |
Domain d1gqwb_: 1gqw B: [70378] complexed with akg, fe2, tau |
PDB Entry: 1gqw (more details), 3 Å
SCOPe Domain Sequences for d1gqwb_:
Sequence, based on SEQRES records: (download)
>d1gqwb_ b.82.2.5 (B:) Taurine/alpha-ketoglutarate dioxygenase TauD {Escherichia coli [TaxId: 562]} erlsitplgpyigaqisgadltrplsdnqfeqlyhavlrhqvvflrdqaitpqqqralaq rfgelhihpvyphaegvdeiivldthndnppdndnwhtdvtfietppagailaakelpst ggdtlwtsgiaayealsvpfrqllsglraehdfrksfpeykyrkteeehqrwreavaknp pllhpvvrthpvsgkqalfvnegfttrivdvsekeseallsflfahitkpefqvrwrwqp ndiaiwdnrvtqhyanadylpqrrimhratilgdkpfyra
>d1gqwb_ b.82.2.5 (B:) Taurine/alpha-ketoglutarate dioxygenase TauD {Escherichia coli [TaxId: 562]} erlsitplgpyigaqisgadrplsdnqfeqlyhavlrhqvvflrdqaitpqqqralaqrf gelhihpvyphaegvdeiivldthndnppdndnwhtdvtfietppagailaakelpstgg dtlwtsgiaayealsvpfrqllsglraehdfrksfpeykyehqrwreavaknppllhpvv rthpvsgkqalfvnegfttrivdvsekeseallsflfahitkpefqvrwrwqpndiaiwd nrvtqhyanadylpqrrimhratilgdkpfyra
Timeline for d1gqwb_: