Lineage for d1gqwb_ (1gqw B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2070014Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2070786Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2070888Family b.82.2.5: TauD/TfdA-like [75038] (5 protein domains)
    automatically mapped to Pfam PF02668
  6. 2070925Protein Taurine/alpha-ketoglutarate dioxygenase TauD [75039] (1 species)
  7. 2070926Species Escherichia coli [TaxId:562] [75040] (4 PDB entries)
  8. 2070938Domain d1gqwb_: 1gqw B: [70378]
    complexed with akg, fe2, tau

Details for d1gqwb_

PDB Entry: 1gqw (more details), 3 Å

PDB Description: taurine/alpha-ketoglutarate dioxygenase from escherichia coli
PDB Compounds: (B:) Alpha-Ketoglutarate-Dependent Taurine Dioxygenase

SCOPe Domain Sequences for d1gqwb_:

Sequence, based on SEQRES records: (download)

>d1gqwb_ b.82.2.5 (B:) Taurine/alpha-ketoglutarate dioxygenase TauD {Escherichia coli [TaxId: 562]}
erlsitplgpyigaqisgadltrplsdnqfeqlyhavlrhqvvflrdqaitpqqqralaq
rfgelhihpvyphaegvdeiivldthndnppdndnwhtdvtfietppagailaakelpst
ggdtlwtsgiaayealsvpfrqllsglraehdfrksfpeykyrkteeehqrwreavaknp
pllhpvvrthpvsgkqalfvnegfttrivdvsekeseallsflfahitkpefqvrwrwqp
ndiaiwdnrvtqhyanadylpqrrimhratilgdkpfyra

Sequence, based on observed residues (ATOM records): (download)

>d1gqwb_ b.82.2.5 (B:) Taurine/alpha-ketoglutarate dioxygenase TauD {Escherichia coli [TaxId: 562]}
erlsitplgpyigaqisgadrplsdnqfeqlyhavlrhqvvflrdqaitpqqqralaqrf
gelhihpvyphaegvdeiivldthndnppdndnwhtdvtfietppagailaakelpstgg
dtlwtsgiaayealsvpfrqllsglraehdfrksfpeykyehqrwreavaknppllhpvv
rthpvsgkqalfvnegfttrivdvsekeseallsflfahitkpefqvrwrwqpndiaiwd
nrvtqhyanadylpqrrimhratilgdkpfyra

SCOPe Domain Coordinates for d1gqwb_:

Click to download the PDB-style file with coordinates for d1gqwb_.
(The format of our PDB-style files is described here.)

Timeline for d1gqwb_: