Lineage for d1gqva_ (1gqv A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1890050Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 1890051Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 1890052Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 1890136Protein Eosinophil-derived neurotoxin (EDN) [64205] (1 species)
  7. 1890137Species Human (Homo sapiens) [TaxId:9606] [64206] (11 PDB entries)
  8. 1890138Domain d1gqva_: 1gqv A: [70376]
    complexed with act

Details for d1gqva_

PDB Entry: 1gqv (more details), 0.98 Å

PDB Description: atomic resolution (0.98a) structure of eosinophil-derived neurotoxin
PDB Compounds: (A:) eosinophil-derived neurotoxin

SCOPe Domain Sequences for d1gqva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gqva_ d.5.1.1 (A:) Eosinophil-derived neurotoxin (EDN) {Human (Homo sapiens) [TaxId: 9606]}
mkppqftwaqwfetqhinmtsqqctnamqvinnyqrrcknqntfllttfanvvnvcgnpn
mtcpsnktrknchhsgsqvplihcnlttpspqnisncryaqtpanmfyivacdnrdqrrd
ppqypvvpvhldrii

SCOPe Domain Coordinates for d1gqva_:

Click to download the PDB-style file with coordinates for d1gqva_.
(The format of our PDB-style files is described here.)

Timeline for d1gqva_: