Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.5: RNase A-like [54075] (1 superfamily) contains long curved beta-sheet and 3 helices |
Superfamily d.5.1: RNase A-like [54076] (2 families) can be classified as disulfide-rich |
Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins) |
Protein Eosinophil-derived neurotoxin (EDN) [64205] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [64206] (11 PDB entries) |
Domain d1gqva_: 1gqv A: [70376] complexed with act |
PDB Entry: 1gqv (more details), 0.98 Å
SCOPe Domain Sequences for d1gqva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gqva_ d.5.1.1 (A:) Eosinophil-derived neurotoxin (EDN) {Human (Homo sapiens) [TaxId: 9606]} mkppqftwaqwfetqhinmtsqqctnamqvinnyqrrcknqntfllttfanvvnvcgnpn mtcpsnktrknchhsgsqvplihcnlttpspqnisncryaqtpanmfyivacdnrdqrrd ppqypvvpvhldrii
Timeline for d1gqva_: