![]() | Class d: Alpha and beta proteins (a+b) [53931] (212 folds) |
![]() | Fold d.5: RNase A-like [54075] (1 superfamily) |
![]() | Superfamily d.5.1: RNase A-like [54076] (1 family) ![]() |
![]() | Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins) |
![]() | Protein Eosinophil-derived neurotoxin (EDN) [64205] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [64206] (6 PDB entries) |
![]() | Domain d1gqva_: 1gqv A: [70376] |
PDB Entry: 1gqv (more details), 0.98 Å
SCOP Domain Sequences for d1gqva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gqva_ d.5.1.1 (A:) Eosinophil-derived neurotoxin (EDN) {Human (Homo sapiens)} mkppqftwaqwfetqhinmtsqqctnamqvinnyqrrcknqntfllttfanvvnvcgnpn mtcpsnktrknchhsgsqvplihcnlttpspqnisncryaqtpanmfyivacdnrdqrrd ppqypvvpvhldrii
Timeline for d1gqva_: