Lineage for d1gqpb_ (1gqp B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2039145Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2039146Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2039519Family b.18.1.9: APC10-like [69210] (2 protein domains)
    Pfam PF03256
  6. 2039520Protein APC10/DOC1 subunit of the anaphase-promoting complex [69211] (2 species)
  7. 2039521Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [74892] (1 PDB entry)
  8. 2039523Domain d1gqpb_: 1gqp B: [70373]
    complexed with br

Details for d1gqpb_

PDB Entry: 1gqp (more details), 2.2 Å

PDB Description: apc10/doc1 subunit of s. cerevisiae
PDB Compounds: (B:) doc1/apc10

SCOPe Domain Sequences for d1gqpb_:

Sequence, based on SEQRES records: (download)

>d1gqpb_ b.18.1.9 (B:) APC10/DOC1 subunit of the anaphase-promoting complex {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
svlvlddrivdaatkdlyvngfqeeiqyqnptpenlqhmfhqgieildsarminvthlal
wkpssfklgnpvdfalddnydtfwqsdggqphqldimfskrmdicvmaiffsmiadesya
pslvkvyaghspsdarfykmlevrnvngwvalrfldnreddqllkcqfirllfpvnheng
kdthlrgirlyvps

Sequence, based on observed residues (ATOM records): (download)

>d1gqpb_ b.18.1.9 (B:) APC10/DOC1 subunit of the anaphase-promoting complex {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
svlvlddrtkdlyvngfqeiqyqnptpenlqhmfhqgieildsarminvthlalwkpssf
klgnpvdfalddnydtfwqsdggqphqldimfskrmdicvmaiffsmiadesyapslvkv
yaghspsdarfykmlevrnvngwvalrfldnreddqllkcqfirllfpvnhengkdthlr
girlyvps

SCOPe Domain Coordinates for d1gqpb_:

Click to download the PDB-style file with coordinates for d1gqpb_.
(The format of our PDB-style files is described here.)

Timeline for d1gqpb_: