Lineage for d1gqmi_ (1gqm I:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 442523Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 442524Superfamily a.39.1: EF-hand [47473] (10 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 442550Family a.39.1.2: S100 proteins [47478] (1 protein)
    dimer: subunits are made of two EF-hands
  6. 442551Protein Calcyclin (S100) [47479] (16 species)
  7. 442558Species Human (Homo sapiens), calgranulin C, s100a12 [TaxId:9606] [47488] (3 PDB entries)
  8. 442575Domain d1gqmi_: 1gqm I: [70368]

Details for d1gqmi_

PDB Entry: 1gqm (more details), 2.7 Å

PDB Description: the structure of s100a12 in a hexameric form and its proposed role in receptor signalling

SCOP Domain Sequences for d1gqmi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gqmi_ a.39.1.2 (I:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12}
tkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavideifqgl
danqdeqvdfqefislvaialkaahyh

SCOP Domain Coordinates for d1gqmi_:

Click to download the PDB-style file with coordinates for d1gqmi_.
(The format of our PDB-style files is described here.)

Timeline for d1gqmi_: