Class a: All alpha proteins [46456] (218 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (10 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.2: S100 proteins [47478] (1 protein) dimer: subunits are made of two EF-hands |
Protein Calcyclin (S100) [47479] (16 species) |
Species Human (Homo sapiens), calgranulin C, s100a12 [TaxId:9606] [47488] (3 PDB entries) |
Domain d1gqmi_: 1gqm I: [70368] |
PDB Entry: 1gqm (more details), 2.7 Å
SCOP Domain Sequences for d1gqmi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gqmi_ a.39.1.2 (I:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12} tkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavideifqgl danqdeqvdfqefislvaialkaahyh
Timeline for d1gqmi_: