Lineage for d1gqmd_ (1gqm D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710100Family a.39.1.2: S100 proteins [47478] (2 proteins)
    dimer: subunits are made of two EF-hands
  6. 2710101Protein Calcyclin (S100) [47479] (17 species)
  7. 2710143Species Human (Homo sapiens), calgranulin C, s100a12 [TaxId:9606] [47488] (3 PDB entries)
  8. 2710155Domain d1gqmd_: 1gqm D: [70363]
    structure in a hexameric form
    complexed with ca

Details for d1gqmd_

PDB Entry: 1gqm (more details), 2.7 Å

PDB Description: the structure of s100a12 in a hexameric form and its proposed role in receptor signalling
PDB Compounds: (D:) calgranulin c

SCOPe Domain Sequences for d1gqmd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gqmd_ a.39.1.2 (D:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]}
tkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavideifqgl
danqdeqvdfqefislvaialkaahyh

SCOPe Domain Coordinates for d1gqmd_:

Click to download the PDB-style file with coordinates for d1gqmd_.
(The format of our PDB-style files is described here.)

Timeline for d1gqmd_: