Lineage for d1gqea_ (1gqe A:)

  1. Root: SCOP 1.63
  2. 266016Class e: Multi-domain proteins (alpha and beta) [56572] (39 folds)
  3. 267404Fold e.38: Polypeptide chain release factor 2 (RF2) [75619] (1 superfamily)
    4 domains: (1) 3-helical bundle; (2) alpha+beta of ferredoxin-like fold (3 and 4) alpha+beta of dsRDB-like fold
  4. 267405Superfamily e.38.1: Polypeptide chain release factor 2 (RF2) [75620] (1 family) (S)
  5. 267406Family e.38.1.1: Polypeptide chain release factor 2 (RF2) [75621] (1 protein)
  6. 267407Protein Polypeptide chain release factor 2 (RF2) [75622] (1 species)
  7. 267408Species Escherichia coli [TaxId:562] [75623] (1 PDB entry)
  8. 267409Domain d1gqea_: 1gqe A: [70351]
    complexed with mse; mutant

Details for d1gqea_

PDB Entry: 1gqe (more details), 1.81 Å

PDB Description: polypeptide chain release factor 2 (rf2) from escherichia coli

SCOP Domain Sequences for d1gqea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gqea_ e.38.1.1 (A:) Polypeptide chain release factor 2 (RF2) {Escherichia coli}
inpvnnriqdltersdvlrgyldydakkerleevnaeleqpdvwneperaqalgkerssl
eavvdtldqmkqgledvsgllelaveaddeetfneavaeldaleeklaqlefrrmfsgey
dsadcyldiqagsggteaqdwasmlermylrwaesrgfkteiieesegevagiksvtiki
sgdyaygwlrtetgvhrlvrkspfdsggrrhtsfssafvypevdddidieinpadlridv
yrasgaggqhvnrtesavrithiptgivtqcqndrsqhknkdqamkqmkaklyevemqkk
naekqamednksdigwgsqirsyvlddsrikdlrtgvetrntqavldgsldqfieaslka
gl

SCOP Domain Coordinates for d1gqea_:

Click to download the PDB-style file with coordinates for d1gqea_.
(The format of our PDB-style files is described here.)

Timeline for d1gqea_: