Lineage for d1gq7d_ (1gq7 D:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 180551Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
  4. 180552Superfamily c.42.1: Arginase/deacetylase [52768] (2 families) (S)
  5. 180553Family c.42.1.1: Arginase-like amidino hydrolases [52769] (2 proteins)
  6. 180618Protein Proclavaminate amidino hydrolase [75227] (1 species)
  7. 180619Species Streptomyces clavuligerus [TaxId:1901] [75228] (2 PDB entries)
  8. 180626Domain d1gq7d_: 1gq7 D: [70347]

Details for d1gq7d_

PDB Entry: 1gq7 (more details), 2.45 Å

PDB Description: proclavaminate amidino hydrolase from streptomyces clavuligerus

SCOP Domain Sequences for d1gq7d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gq7d_ c.42.1.1 (D:) Proclavaminate amidino hydrolase {Streptomyces clavuligerus}
spryaqiptfmrlphdpqprgydvvvigapydggtsyrpgarfgpqairsesglihgvgi
drgpgtfdlincvdagdinltpfdmniaidtaqshlsgllkanaaflmiggdhsltvaal
ravaeqhgplavvhldahsdtnpafyggryhhgtpfrhgideklidpaamvqigirghnp
kpdsldyarghgvrvvtadefgelgvggtadlirekvgqrpvyvsvdidvvdpafapgtg
tpapggllsrevlallrcvgdlkpvgfdvmevsplydhggitsilateigaellyqyara
h

SCOP Domain Coordinates for d1gq7d_:

Click to download the PDB-style file with coordinates for d1gq7d_.
(The format of our PDB-style files is described here.)

Timeline for d1gq7d_: