Lineage for d1gq6c_ (1gq6 C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2115321Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 2115322Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. 2115323Family c.42.1.1: Arginase-like amidino hydrolases [52769] (5 protein domains)
    Pfam PF00491
  6. 2115556Protein Proclavaminate amidino hydrolase [75227] (1 species)
  7. 2115557Species Streptomyces clavuligerus [TaxId:1901] [75228] (2 PDB entries)
  8. 2115560Domain d1gq6c_: 1gq6 C: [70343]
    complexed with mn

Details for d1gq6c_

PDB Entry: 1gq6 (more details), 1.75 Å

PDB Description: proclavaminate amidino hydrolase from streptomyces clavuligerus
PDB Compounds: (C:) proclavaminate amidino hydrolase

SCOPe Domain Sequences for d1gq6c_:

Sequence, based on SEQRES records: (download)

>d1gq6c_ c.42.1.1 (C:) Proclavaminate amidino hydrolase {Streptomyces clavuligerus [TaxId: 1901]}
spryaqiptfmrlphdpqprgydvvvigapydggtsyrpgarfgpqairsesglihgvgi
drgpgtfdlincvdagdinltpfdmniaidtaqshlsgllkanaaflmiggdhsltvaal
ravaeqhgplavvhldahsdtnpafyggryhhgtpfrhgideklidpaamvqigirghnp
kpdsldyarghgvrvvtadefgelgvggtadlirekvgqrpvyvsvdidvvdpafapgtg
tpapggllsrevlallrcvgdlkpvgfdvmevsplydhggitsilateigaellyqyara
h

Sequence, based on observed residues (ATOM records): (download)

>d1gq6c_ c.42.1.1 (C:) Proclavaminate amidino hydrolase {Streptomyces clavuligerus [TaxId: 1901]}
spryaqiptfmrlphdpqprgydvvvigapydggtsyrpgarfgpqairsesglihgvgi
dgtfdlincvdagdinltpfdmniaidtaqshlsgllkanaaflmiggdhsltvaalrav
aeqhgplavvhldahsdtnpafyggryhhgtpfrhgideklidpaamvqigirghldyar
ghgvrvvtadefgelgvggtadlirekvgqrpvyvsvdidvvdpafapgtgtpapgglls
revlallrcvgdlkpvgfdvmevsplydhggitsilateigaellyqyarah

SCOPe Domain Coordinates for d1gq6c_:

Click to download the PDB-style file with coordinates for d1gq6c_.
(The format of our PDB-style files is described here.)

Timeline for d1gq6c_: