SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1gq6c_ (1gq6 C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2115321Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 2115322Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. 2115323Family c.42.1.1: Arginase-like amidino hydrolases [52769] (5 protein domains)
    Pfam PF00491
  6. 2115556Protein Proclavaminate amidino hydrolase [75227] (1 species)
  7. 2115557Species Streptomyces clavuligerus [TaxId:1901] [75228] (2 PDB entries)
  8. 2115560Domain d1gq6c_: 1gq6 C: [70343]
    complexed with mn

Details for d1gq6c_

PDB Entry: 1gq6 (more details), 1.75 Å

PDB Description: proclavaminate amidino hydrolase from streptomyces clavuligerus
PDB Compounds: (C:) proclavaminate amidino hydrolase

SCOPe Domain Sequences for d1gq6c_:

Sequence, based on SEQRES records: (download)

>d1gq6c_ c.42.1.1 (C:) Proclavaminate amidino hydrolase {Streptomyces clavuligerus [TaxId: 1901]}
spryaqiptfmrlphdpqprgydvvvigapydggtsyrpgarfgpqairsesglihgvgi
drgpgtfdlincvdagdinltpfdmniaidtaqshlsgllkanaaflmiggdhsltvaal
ravaeqhgplavvhldahsdtnpafyggryhhgtpfrhgideklidpaamvqigirghnp
kpdsldyarghgvrvvtadefgelgvggtadlirekvgqrpvyvsvdidvvdpafapgtg
tpapggllsrevlallrcvgdlkpvgfdvmevsplydhggitsilateigaellyqyara
h

Sequence, based on observed residues (ATOM records): (download)

>d1gq6c_ c.42.1.1 (C:) Proclavaminate amidino hydrolase {Streptomyces clavuligerus [TaxId: 1901]}
spryaqiptfmrlphdpqprgydvvvigapydggtsyrpgarfgpqairsesglihgvgi
dgtfdlincvdagdinltpfdmniaidtaqshlsgllkanaaflmiggdhsltvaalrav
aeqhgplavvhldahsdtnpafyggryhhgtpfrhgideklidpaamvqigirghldyar
ghgvrvvtadefgelgvggtadlirekvgqrpvyvsvdidvvdpafapgtgtpapgglls
revlallrcvgdlkpvgfdvmevsplydhggitsilateigaellyqyarah

SCOPe Domain Coordinates for d1gq6c_:

Click to download the PDB-style file with coordinates for d1gq6c_.
(The format of our PDB-style files is described here.)

Timeline for d1gq6c_: