Lineage for d1gq2m1 (1gq2 M:280-580)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 175017Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 175018Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) (S)
  5. 175982Family c.2.1.7: Amino-acid dehydrogenase-like, C-terminal domain [51883] (5 proteins)
  6. 176073Protein Mitochondrial NAD(P)-dependenent malic enzyme [51898] (3 species)
  7. 176074Species Domestic pigeon (Columba livia) [TaxId:8932] [75116] (1 PDB entry)
  8. 176087Domain d1gq2m1: 1gq2 M:280-580 [70332]
    Other proteins in same PDB: d1gq2a2, d1gq2b2, d1gq2c2, d1gq2d2, d1gq2e2, d1gq2f2, d1gq2g2, d1gq2h2, d1gq2i2, d1gq2j2, d1gq2k2, d1gq2l2, d1gq2m2, d1gq2n2, d1gq2o2, d1gq2p2

Details for d1gq2m1

PDB Entry: 1gq2 (more details), 2.5 Å

PDB Description: malic enzyme from pigeon liver

SCOP Domain Sequences for d1gq2m1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gq2m1 c.2.1.7 (M:280-580) Mitochondrial NAD(P)-dependenent malic enzyme {Domestic pigeon (Columba livia)}
iqgtasvavagllaalritknrlsdhtvlfqgageaalgianlivmamqkegvskeeaik
riwmvdskglivkgrasltpekehfahehcemknledivkdikptvligvaaiggaftqq
ilqdmaafnkrpiifalsnptskaectaeqlykytegrgifasgspfdpvtlpsgqtlyp
gqgnnsyvfpgvalgviscglkhigddvflttaeviaqevseenlqegrlypplvtiqqv
slkiavriakeayrnntastypqpedleafirsqvystdyncfvadsytwpeeamkvk

SCOP Domain Coordinates for d1gq2m1:

Click to download the PDB-style file with coordinates for d1gq2m1.
(The format of our PDB-style files is described here.)

Timeline for d1gq2m1: