Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.135: The spindle assembly checkpoint protein mad2 [56018] (1 superfamily) core: alpha(2)-beta(2)-alpha-beta; mixed sheet: order 213 |
Superfamily d.135.1: The spindle assembly checkpoint protein mad2 [56019] (2 families) N- and C-termini undergo large conformational rearrangement upon ligand binding automatically mapped to Pfam PF02301 |
Family d.135.1.1: The spindle assembly checkpoint protein mad2 [56020] (2 proteins) |
Protein The spindle assembly checkpoint protein mad2 [56021] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [56022] (5 PDB entries) |
Domain d1go4d_: 1go4 D: [70295] Other proteins in same PDB: d1go4e_, d1go4f_, d1go4g_, d1go4h_ complex with mad1 |
PDB Entry: 1go4 (more details), 2.05 Å
SCOPe Domain Sequences for d1go4d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1go4d_ d.135.1.1 (D:) The spindle assembly checkpoint protein mad2 {Human (Homo sapiens) [TaxId: 9606]} itlrgsaeivaeffsfginsilyqrgiypsetftrvqkygltllvttdlelikylnnvve qlkdwlykcsvqklvvvisniesgevlerwqfdiecdktakddsapreksqkaiqdeirs viaqitatvtflpllevscsfdlliytdkdlvvpekweesgpqfitnseevrlrsfttti hkvnsmvaykipv
Timeline for d1go4d_: