Lineage for d1go4c_ (1go4 C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2977796Fold d.135: The spindle assembly checkpoint protein mad2 [56018] (1 superfamily)
    core: alpha(2)-beta(2)-alpha-beta; mixed sheet: order 213
  4. 2977797Superfamily d.135.1: The spindle assembly checkpoint protein mad2 [56019] (2 families) (S)
    N- and C-termini undergo large conformational rearrangement upon ligand binding
    automatically mapped to Pfam PF02301
  5. 2977798Family d.135.1.1: The spindle assembly checkpoint protein mad2 [56020] (2 proteins)
  6. 2977799Protein The spindle assembly checkpoint protein mad2 [56021] (1 species)
  7. 2977800Species Human (Homo sapiens) [TaxId:9606] [56022] (5 PDB entries)
  8. 2977805Domain d1go4c_: 1go4 C: [70294]
    Other proteins in same PDB: d1go4e_, d1go4f_, d1go4g_, d1go4h_
    complex with mad1

Details for d1go4c_

PDB Entry: 1go4 (more details), 2.05 Å

PDB Description: crystal structure of mad1-mad2 reveals a conserved mad2 binding motif in mad1 and cdc20.
PDB Compounds: (C:) mitotic spindle assembly checkpoint protein mad2a

SCOPe Domain Sequences for d1go4c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1go4c_ d.135.1.1 (C:) The spindle assembly checkpoint protein mad2 {Human (Homo sapiens) [TaxId: 9606]}
gitlrgsaeivaeffsfginsilyqrgiypsetftrvqkygltllvttdlelikylnnvv
eqlkdwlykcsvqklvvvisniesgevlerwqfdiecdktakddsapreksqkaiqdeir
sviaqitatvtflpllevscsfdlliytdkdlvvpekweesgpqfitnseevrlrsfttt
ihkvnsmvaykipvn

SCOPe Domain Coordinates for d1go4c_:

Click to download the PDB-style file with coordinates for d1go4c_.
(The format of our PDB-style files is described here.)

Timeline for d1go4c_: