SCOP 1.61: Domain d1gn1h_: 1gn1 H:

Lineage for d1gn1h_ (1gn1 H:)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (5 superfamilies)

4. Superfamily c.8.5: GroEL-like chaperone, apical domain [52029] (2 families)

5. Family c.8.5.2: Group II chaperonin (CCT, TRIC) [52034] (1 protein)

6. Protein Thermosome [52035] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [75137] (2 PDB entries)

8. Domain d1gn1h_: 1gn1 H: [70284]

Details for d1gn1h_

PDB Entry: 1gn1, 2.8 Å

PDB Description: crystal structure of the mouse cct gamma apical domain (monoclinic)

SCOP Domain Sequences for d1gn1h_:

Sequence, based on SEQRES records:

>d1gn1h_ c.8.5.2 (H:) Thermosome {Mouse (Mus musculus)}
lrgvminkdvthprmrryiknprivlldssleykkgesqtdieitreedftrilqmeeey
ihqlcediiqlkpdvvitekgisdlaqhylmranvtairrvrktdnnriaracgarivsr
peelreddvgtgaglleikkigdeyftfitdckdpkactill

Sequence, based on observed residues (ATOM records):

>d1gn1h_ c.8.5.2 (H:) Thermosome {Mouse (Mus musculus)}
lrgvminkdvthprmrryiknprivlldssleytrilqmeeeyihqlcediiqlkpdvvi
tekgisdlaqhylmranvtairrvrktdnnriaracgarivsrpeelreddvgtgaglle
ikkigdeyftfitdckdpkactill

Timeline for d1gn1h_:

• d1gn1h_ is new in SCOP 1.61
  
• d1gn1h_ appears in SCOP 1.63
  
• d1gn1h_ appears in the current release, SCOPe 2.08