Lineage for d1gn1c_ (1gn1 C:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 310107Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (7 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in all proteins known to contain it
  4. 310214Superfamily c.8.5: GroEL apical domain-like [52029] (2 families) (S)
  5. 310275Family c.8.5.2: Group II chaperonin (CCT, TRIC), apical domain [52034] (1 protein)
  6. 310276Protein Thermosome, A-domain [52035] (2 species)
  7. 310285Species Mouse (Mus musculus) [TaxId:10090] [75137] (2 PDB entries)
  8. 310292Domain d1gn1c_: 1gn1 C: [70279]

Details for d1gn1c_

PDB Entry: 1gn1 (more details), 2.8 Å

PDB Description: crystal structure of the mouse cct gamma apical domain (monoclinic)

SCOP Domain Sequences for d1gn1c_:

Sequence, based on SEQRES records: (download)

>d1gn1c_ c.8.5.2 (C:) Thermosome, A-domain {Mouse (Mus musculus)}
dscvlrgvminkdvthprmrryiknprivlldssleykkgesqtdieitreedftrilqm
eeeyihqlcediiqlkpdvvitekgisdlaqhylmranvtairrvrktdnnriaracgar
ivsrpeelreddvgtgaglleikkigdeyftfitdckdpkactil

Sequence, based on observed residues (ATOM records): (download)

>d1gn1c_ c.8.5.2 (C:) Thermosome, A-domain {Mouse (Mus musculus)}
dscvlrgvminkdvthprmrryiknprivlldssleyeyihqlcediiqlkpdvvitekg
isdlaqhylmranvtairrvrktdnnriaracgarivsrpeelreddvgtgaglleikki
gdeyftfitdckdpkactil

SCOP Domain Coordinates for d1gn1c_:

Click to download the PDB-style file with coordinates for d1gn1c_.
(The format of our PDB-style files is described here.)

Timeline for d1gn1c_: